STIMATE Rabbit Polyclonal Antibody

CAT#: TA333351

Rabbit Polyclonal Anti-TMEM110 Antibody

Product Images

WB Suggested Anti-TMEM110 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateTMEM110 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM110 Antibody: synthetic peptide directed towards the N terminal of human TMEM110. Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: transmembrane protein 110
• Database Link:
  NP_940965
  Entrez Gene 375346 Human
  UniProt ID Q86TL2
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp667E1121; DKFZp779M0254; FLJ37613; FLJ42395; MGC52022
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 86%

Reference Data

• Protein Families: Transmembrane