SLC6A15 Rabbit Polyclonal Antibody

CAT#: TA333381

Rabbit Polyclonal Anti-SLC6A15 Antibody

Product Images

WB Suggested Anti-SLC6A15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC6A15 Antibody: synthetic peptide directed towards the N terminal of human SLC6A15. Synthetic peptide located within the following region: DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: solute carrier family 6 member 15
• Database Link:
  NP_877499
  Entrez Gene 55117 Human
  UniProt ID Q9H2J7
• Background: SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.
• Synonyms: hv7-3; NTT73; SBAT1; V7-3
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane