WDR21A (DCAF4) Rabbit Polyclonal Antibody

CAT#: TA333413

Rabbit Polyclonal Anti-DCAF4 Antibody

Product Images

WB Suggested Anti-WDR21A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: DCAF4; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; DCAF4 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IP, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DCAF4 Antibody: synthetic peptide directed towards the middle region of human DCAF4. Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: DDB1 and CUL4 associated factor 4
• Database Link:
  NP_851937
  Entrez Gene 26094 Human
  UniProt ID Q8WV16
• Background: DCAF4 is a WD repeat-containing protein. The function of DCAF4 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Synonyms: WDR21; WDR21A
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Mouse: 79%