G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody

CAT#: TA333537

Rabbit Polyclonal Anti-GNAO1 Antibody

Product Images

WB Suggested Anti-GNAO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

• 

  Lanes: Lane 1: INS1 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Donkey anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Gene Name: GNAO1; Submitted by: Olivier Costa, Diabetes research center VUB

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the N terminal of human GNAO1. Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: G protein subunit alpha o1
• Database Link:
  NP_620073
  Entrez Gene 50664 RatEntrez Gene 2775 Human
  UniProt ID P09471
• Background: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain
• Synonyms: EIEE17; G-ALPHA-o; GNAO; HLA-DQB1
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression, Melanogenesis