G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
Other products for "GNAO1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human, Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the N terminal of human GNAO1. Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 40 kDa |
| Gene Name | G protein subunit alpha o1 |
| Database Link | |
| Background | Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain |
| Synonyms | EIEE17; G-ALPHA-o; GNAO; HLA-DQB1 |
| Note | Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Long-term depression, Melanogenesis |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China