PLA2G12B Rabbit Polyclonal Antibody

CAT#: TA333609

Rabbit Polyclonal Anti-PLA2G12B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PLA2G12B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 19 kDa
Gene Name phospholipase A2 group XIIB
Background Phospholipase A2 (PLA2) enzymes catalyze hydrolysis of glycolipids to release free fatty acids and lysophospholipids. PLA2G12B belongs to the PLA2 family, but it is catalytically inactive due to an amino acid change in its active site and has altered phospholipid-binding properties.
Synonyms FKSG71; GXIIB; GXIIIsPLA2; PLA2G13; sPLA2-GXIIB
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 79%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Secreted Protein
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.