GNGT2 Rabbit Polyclonal Antibody

CAT#: TA333628

Rabbit Polyclonal Anti-GNGT2 Antibody

Product Images

WB Suggested Anti-GNGT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GNGT2 Antibody: synthetic peptide directed towards the middle region of human GNGT2. Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 8 kDa
• Gene Name: G protein subunit gamma transducin 2
• Database Link:
  NP_113686
  Entrez Gene 2793 Human
  UniProt ID O14610
• Background: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.
• Synonyms: G-GAMMA-8; G-GAMMA-C; GNG8; GNG9; GNGT8
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Bovine: 93%; Rabbit: 92%; Horse: 86%; Mouse: 86%; Rat: 85%; Pig: 77%; Sheep: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway