PAAF1 Rabbit Polyclonal Antibody

CAT#: TA333657

Rabbit Polyclonal Anti-PAAF1 Antibody

Product Images

WB Suggested Anti-PAAF1 Antibody; Titration: 1.0 ug/ml; Positive Control: HT1080 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PAAF1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PAAF1. Synthetic peptide located within the following region: FTVNEINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: proteasomal ATPase associated factor 1
• Database Link:
  NP_079431
  Entrez Gene 80227 Human
  UniProt ID Q9BRP4
• Background: This gene encodes a WD repeat-containing protein involved in regulation of association of proteasome components. During HIV infection, the encoded protein is thought to promote provirus transcription through recruitment of the 19S regulatory complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: PAAF; Rpn14; WDR71
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 86%