JMJD5 (KDM8) Rabbit Polyclonal Antibody

CAT#: TA333663

Rabbit Polyclonal Anti-FLJ13798 Antibody

Product Images

WB Suggested Anti-FLJ13798 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FLJ13798 Antibody: synthetic peptide directed towards the C terminal of human FLJ13798. Synthetic peptide located within the following region: YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: lysine demethylase 8
• Database Link:
  NP_079049
  Entrez Gene 79831 Human
  UniProt ID Q8N371
• Background: The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
• Synonyms: JMJD5
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 85%