FOXL2 Rabbit Antibody

CAT#: TA333693

Rabbit Polyclonal Anti-Foxl2 Antibody

Specifications

Product Data

• Reactivities: Bovine, Dog, Goat, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-Foxl2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHFQPGKGLFGSGGGAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLP
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Database Link:
  NP_075555
  Entrez Gene 367152 Rat
• Background: FOXL2 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
• Synonyms: BPES; BPES1; PFRK; PINTO; POF3
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%; African clawed frog: 78%; Chicken: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors