PKNOX2 Rabbit Polyclonal Antibody

CAT#: TA333708

Rabbit Polyclonal Anti-PKNOX2 Antibody

Product Images

WB Suggested Anti-PKNOX2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PKNOX2 Antibody: synthetic peptide directed towards the N terminal of human PKNOX2. Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: PBX/knotted 1 homeobox 2
• Database Link:
  NP_071345
  Entrez Gene 63876 Human
  UniProt ID Q96KN3
• Background: PKNOX2 is a TALE homeodomain protein that shows distinct homology with PKNOX1. It may interact with PBX proteins and play a tissue-specific regulation of transcription.
• Synonyms: PREP2
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%

Reference Data

• Protein Families: Transcription Factors