APOBEC3G Rabbit Polyclonal Antibody

CAT#: TA333717

Rabbit Polyclonal Anti-APOBEC3G Antibody

Product Images

WB Suggested Anti-APOBEC3G Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Daudi cell lysate

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 3G
• Database Link:
  NP_068594
  Entrez Gene 60489 Human
  UniProt ID Q9HC16
• Background: APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity.
• Synonyms: A3G; ARCD; ARP-9; ARP9; bK150C2.7; CEM-15; CEM15; dJ494G10.1; MDS019
• Note: Immunogen sequence homology: Human: 100%; Pig: 79%