SLC15A2 Rabbit Polyclonal Antibody

CAT#: TA333731

Rabbit Polyclonal Anti-SLC15A2 Antibody

Product Images

WB Suggested Anti-SLC15A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysateSLC15A2 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC15A2 Antibody: synthetic peptide directed towards the middle region of human SLC15A2. Synthetic peptide located within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: solute carrier family 15 member 2
• Database Link:
  NP_066568
  Entrez Gene 6565 Human
  UniProt ID Q16348
• Background: SLC15A2 belongs to the PTR2/POT transporter (TC 2.A.17) family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
• Synonyms: PEPT2
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Dog: 83%; Rat: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane