KCC2 (SLC12A5) Rabbit Polyclonal Antibody

CAT#: TA333736

Rabbit Polyclonal Anti-SLC12A5 Antibody

Product Images

WB Suggested Anti-SLC12A5 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC12A5 Antibody: synthetic peptide directed towards the middle region of human SLC12A5. Synthetic peptide located within the following region: VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: solute carrier family 12 member 5
• Database Link:
  NP_065759
  Entrez Gene 57468 Human
  UniProt ID Q9H2X9
• Background: K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The protein encoded by this gene is an integral membrane K-Cl cotransporter that can function in either a net efflux or influx pathway, depending on the chemical concentration gradients of potassium and chloride. The encoded protein can act as a homomultimer, or as a heteromultimer with other K-Cl cotransporters, to maintain chloride homeostasis in neurons. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Sep 2008]
• Synonyms: EIEE34; EIG14; hKCC2; KCC2
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Mouse: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane