SLC43A3 Rabbit Polyclonal Antibody

CAT#: TA333769

Rabbit Polyclonal Anti-SLC43A3 Antibody

Product Images

WB Suggested Anti-SLC43A3 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate;SLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC43A3 Antibody: synthetic peptide directed towards the N terminal of human SLC43A3. Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: solute carrier family 43 member 3
• Database Link:
  NP_060081
  Entrez Gene 29015 Human
  UniProt ID Q8NBI5
• Background: SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.
• Synonyms: EEG1; FOAP-13; PRO1659; SEEEG-1
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Rabbit: 92%; Horse: 86%

Reference Data

• Protein Families: Transmembrane