SLC2A6 Rabbit Polyclonal Antibody

CAT#: TA333771

Rabbit Polyclonal Anti-SLC2A6 Antibody

Product Images

WB Suggested Anti-SLC2A6 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the C terminal of human SLC2A6. Synthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: solute carrier family 2 member 6
• Database Link:
  NP_060055
  Entrez Gene 11182 Human
  UniProt ID Q9UGQ3
• Background: Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues. [supplied by OMIM]
• Synonyms: GLUT6; GLUT9; HSA011372
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane