Claudin18 (CLDN18) Rabbit Polyclonal Antibody

CAT#: TA333778

Rabbit Polyclonal Anti-CLDN18 Antibody

Product Images

WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLDN18 Antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: claudin 18
• Database Link:
  NP_057453
  Entrez Gene 51208 Human
  UniProt ID P56856
• Background: CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-282 AY358479.1 28-309 283-1864 AK098474.1 274-1855 1865-2307 BM785703.1 143-585 2308-2868 AK098474.1 2297-2857 2869-3359 AY102073.1 394-884
• Synonyms: SFTA5; SFTPJ
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction