HIC5 (TGFB1I1) Rabbit Polyclonal Antibody
Other products for "TGFB1I1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | IHC, WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TGFB1I1 Antibody is: synthetic peptide directed towards the middle region of Human TGFB1I1. Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 48 kDa |
Gene Name | transforming growth factor beta 1 induced transcript 1 |
Database Link | |
Background | The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer. |
Synonyms | ARA55; HIC-5; HIC5; TSC-5 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Goat: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.