ZCCHC14 Rabbit Polyclonal Antibody

CAT#: TA333842

Rabbit Polyclonal Anti-ZCCHC14 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "ZCCHC14"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZCCHC14 Antibody: synthetic peptide directed towards the N terminal of human ZCCHC14. Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 100 kDa
Gene Name zinc finger CCHC-type containing 14
Background ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.
Synonyms BDG-29; BDG29
Note Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.