KIFAP3 Rabbit Polyclonal Antibody

CAT#: TA333859

Rabbit Polyclonal Anti-KIFAP3 Antibody

Product Images

WB Suggested Anti-KIFAP3 Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate

• 

  Host: Rabbit; Target Name: KIFAP3; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KIFAP3 Antibody: synthetic peptide directed towards the middle region of human KIFAP3. Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: kinesin associated protein 3
• Database Link:
  NP_055785
  Entrez Gene 22920 Human
  UniProt ID Q92845
• Background: The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.
• Synonyms: dJ190I16.1; FLA3; KAP-1; KAP-3; KAP3; SMAP; Smg-GDS
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome