SLC40A1 Rabbit Polyclonal Antibody

CAT#: TA333866

Rabbit Polyclonal Anti-SLC40A1 Antibody

Product Images

WB Suggested Anti-SLC40A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC40A1 Antibody: synthetic peptide directed towards the middle region of human SLC40A1. Synthetic peptide located within the following region: GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: solute carrier family 40 member 1
• Database Link:
  NP_055400
  Entrez Gene 30061 Human
  UniProt ID Q9NP59
• Background: The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4).
• Synonyms: FPN1; HFE4; IREG1; MST079; MSTP079; MTP1; SLC11A3
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane