LSM5 Rabbit Polyclonal Antibody

CAT#: TA333880

Rabbit Polyclonal Anti-LSM5 Antibody

Product Images

WB Suggested Anti-LSM5 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole CellLSM5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LSM5 Antibody is: synthetic peptide directed towards the middle region of Human LSM5. Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
• Database Link:
  NP_036454
  Entrez Gene 23658 Human
  UniProt ID Q9Y4Y9
• Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
• Synonyms: YER146W
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation, Spliceosome