Usp12 Rabbit Polyclonal Antibody

CAT#: TA333885

Rabbit Polyclonal Anti-Usp12 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Usp12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Usp12 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Usp12. Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 41 kDa
Gene Name ubiquitin specific peptidase 12
Background Usp12 is a deubiquitinating enzyme. It has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitination of monoubiquitinated FANCD2.
Synonyms UBH1; USP12L1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.