SOX10 Rabbit Polyclonal Antibody

CAT#: TA333906

Rabbit Polyclonal Anti-SOX10 Antibody

Product Images

WB Suggested Anti-SOX10Antibody Titration: 0.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.

• 

  Host: Rabbit; Target Name: SOX10; Sample Tissue: Jurkat cell lysates; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5 ug/ml; Peptide Concentration: 4.0ug/ml; Lysate Quantity: 25ug/lane; Gel Concen

• 

  Immunohistochemistry with Skin tissue at an antibody concentration of 4-8 ug/ml using anti-SOX10 antibody

• 

  Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8 ug/ml using anti-SOX10 antibody

• 

  A/ [IHC-PZ] (optimal processing) human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in pa

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: SRY-box 10
• Database Link:
  NP_008872
  Entrez Gene 6663 Human
  UniProt ID P56693
• Background: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Synonyms: DOM; PCWH; WS2E; WS4; WS4C
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%

Reference Data

• Protein Families: Adult stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors