SLC9A5 Rabbit Polyclonal Antibody

CAT#: TA333969

Rabbit Polyclonal Anti-Slc9a5 Antibody

Product Images

WB Suggested Anti-Slc9a5 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc9a5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 99 kDa
• Gene Name: solute carrier family 9 member A5
• Database Link:
  NP_004585
  Entrez Gene 277973 Mouse
  UniProt ID Q14940
• Background: The function of this protein remains unknown.
• Synonyms: NHE5
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane