ZNF235 Rabbit Polyclonal Antibody

CAT#: TA333975

Rabbit Polyclonal Anti-ZNF235 Antibody

Product Images

Host: Rabbit; Target Name: ZNF235; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF235 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF235. Synthetic peptide located within the following region: FRNLVSVGHQSFKPDMISQLEREEKLWMKELQTQRGKHSGDRNQNEMATL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: zinc finger protein 235
• Database Link:
  NP_004225
  Entrez Gene 9310 Human
  UniProt ID Q14590
• Background: This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the Kruppel family of zinc finger proteins, and contains Kruppel-associated box (KRAB) A and B domains and 15 tandemly arrayed C2H2-type zinc fingers. It is an ortholog of the mouse Zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2.
• Synonyms: ANF270; HZF6; ZFP93; ZNF270
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Pig: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transcription Factors