SLC16A3 Rabbit Antibody

CAT#: TA333978

Rabbit Polyclonal Anti-Slc16a3 Antibody

Specifications

Product Data

• Reactivities: Human, Horse, Rat, Pig, Zebrafish, Mouse, Dog, Bovine, Rabbit, Guinea pig
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-Slc16a3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Database Link:
  NP_004198
  Entrez Gene 80879 Mouse
• Background: Slc16a3 is a proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
• Synonyms: MCT-3; MCT-4; MCT 3; MCT3; MCT 4; MCT4
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Dog: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane