FATP2 (SLC27A2) Rabbit Polyclonal Antibody

CAT#: TA333990

Rabbit Polyclonal Anti-SLC27A2 Antibody

Product Images

WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml; Positive Control: Hela cell lysate

• 

  WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml; Positive Control: Jurkat lysate

• 

  Host: Rabbit; Target Name: SLC27A2; Sample Tissue: Hela; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1 ug/ml; Peptide Concentration: 5.0 ug/ml; Lysate Quantity: 25ug/lane/lane; Gel Concentration: 12

• 

  Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)

• 

  Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: solute carrier family 27 member 2
• Database Link:
  NP_003636
  Entrez Gene 11001 Human
  UniProt ID O14975
• Background: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
• Synonyms: ACSVL1; FACVL1; FATP2; hFACVL1; HsT17226; VLACS; VLCS
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: PPAR signaling pathway