ZFP37 Rabbit Polyclonal Antibody

CAT#: TA334008

Rabbit Polyclonal Anti-ZFP37 Antibody

Product Images

WB Suggested Anti-ZFP37 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateZFP37 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFP37 Antibody: synthetic peptide directed towards the middle region of human ZFP37. Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: ZFP37 zinc finger protein
• Database Link:
  NP_003399
  Entrez Gene 7539 Human
  UniProt ID Q9Y6Q3
• Background: ZFP37 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZFP37 may be involved in transcriptional regulation.
• Synonyms: zfp-37; ZNF906
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 92%; Pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors