ZFP37 Rabbit Polyclonal Antibody

CAT#: TA334008

Rabbit Polyclonal Anti-ZFP37 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZFP37"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZFP37 Antibody: synthetic peptide directed towards the middle region of human ZFP37. Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name ZFP37 zinc finger protein
Background ZFP37 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZFP37 may be involved in transcriptional regulation.
Synonyms zfp-37; ZNF906
Note Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 92%; Pig: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.