USF2 Rabbit Polyclonal Antibody

CAT#: TA334011

Rabbit Polyclonal Anti-USF2 Antibody

Product Images

WB Suggested Anti-USF2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-USF2 Antibody: synthetic peptide directed towards the N terminal of human USF2. Synthetic peptide located within the following region: GDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: upstream transcription factor 2, c-fos interacting
• Database Link:
  NP_003358
  Entrez Gene 7392 Human
  UniProt ID Q15853
• Background: USF2 is a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. It can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: bHLHb12; FIP
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors