SLC9A3R2 Rabbit Antibody

CAT#: TA334086

Rabbit Polyclonal Anti-Slc9a3r2 Antibody

Specifications

Product Data

• Reactivities: Rat, Guinea pig, Human, Mouse, Rabbit, Dog, Bovine, Horse
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-Slc9a3r2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Database Link:
  NP_001123484
  Entrez Gene 116501 Rat
• Background: Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Slc9a3r2 is necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. It may also act as scaffold protein in the nucleus.
• Synonyms: E3KARP; NHE3RF2; NHERF-2; NHERF2; OCTS2; SIP-1; SIP1; TKA-1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome