PIH1D2 Rabbit Polyclonal Antibody

CAT#: TA334113

Rabbit Polyclonal Anti-PIH1D2 Antibody

Product Images

Host: Rabbit; Target Name: PIH1D2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PIH1D2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PIH1D2. Synthetic peptide located within the following region: SKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: PIH1 domain containing 2
• Database Link:
  NP_001076088
  Entrez Gene 120379 Human
  UniProt ID Q8WWB5
• Background: The function of this protein remains unknown.
• Synonyms: PIH1 domain containing 2
• Note: Immunogen sequence homology: Human: 100%; Dog: 79%; Pig: 79%; Horse: 79%; Rabbit: 79%