PPP1R1C Rabbit Polyclonal Antibody

CAT#: TA334115

Rabbit Polyclonal Anti-PPP1R1C Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PPP1R1C"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PPP1R1C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R1C. Synthetic peptide located within the following region: GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 11 kDa
Gene Name protein phosphatase 1 regulatory inhibitor subunit 1C
Background Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation.
Synonyms IPP5
Note Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85%
Reference Data
Protein Families Druggable Genome, Phosphatase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.