SLC39A7 Rabbit Polyclonal Antibody

CAT#: TA334120

Rabbit Polyclonal Anti-SLC39A7 Antibody

Product Images

WB Suggested Anti-SLC39A7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A7 Antibody: synthetic peptide directed towards the N terminal of human SLC39A7. Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: solute carrier family 39 member 7
• Database Link:
  NP_001070984
  Entrez Gene 7922 Human
  UniProt ID Q92504
• Background: Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments. [supplied by OMIM]
• Synonyms: D6S115E; D6S2244E; H2-KE4; HKE4; KE4; RING5; ZIP7
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane