Camk2b Rabbit Polyclonal Antibody

CAT#: TA334128

Rabbit Polyclonal Anti-Camk2b Antibody

Product Images

Host: Rabbit; Target Name: Camk2b; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Camk2b Antibody is: synthetic peptide directed towards the middle region of Rat Camk2b. Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: calcium/calmodulin-dependent protein kinase II beta
• Database Link:
  NP_001035813
  Entrez Gene 24245 Rat
  UniProt ID P08413
• Background: beta subunit of calcium/calmodulin-dependent protein kinase II; may be involved in retinal development [RGD, Feb 2006]. Transcript Variant: This variant (2) has multiple differences in the coding region, compared to variant 1. The resulting protein (isoform 2) is shorter when it is compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
• Synonyms: CAM2; CAMK2; CAMKB; MGC29528; OTTHUMP00000159355; OTTHUMP00000159356; OTTHUMP00000209343
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Yeast: 93%; Rabbit: 93%