Constitutive androstane receptor (NR1I3) Rabbit Polyclonal Antibody

CAT#: TA334219

Rabbit Polyclonal Anti-NR1I3 Antibody

Product Images

WB Suggested Anti-NR1I3 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3. Synthetic peptide located within the following region: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: nuclear receptor subfamily 1 group I member 3
• Database Link:
  NP_005113
  Entrez Gene 9970 Human
  UniProt ID Q14994
• Background: NR1I3 is a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members.
• Synonyms: CAR; CAR1; MB67
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 85%; Dog: 77%; Bovine: 77%; Horse: 75%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors