CBF1 interacting corepressor (CIR1) Rabbit Polyclonal Antibody

CAT#: TA334245

Rabbit Polyclonal Anti-CIR Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CIR1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CIR antibody: synthetic peptide directed towards the middle region of human CIR. Synthetic peptide located within the following region: SGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name corepressor interacting with RBPJ, 1
Background CIR may modulate splice site selection during alternative splicing of pre-mRNAs. CIR regulates transcription and acts as corepressor for RBPSUH by recruiting RBPSUH to the Sin3-histone deacetylase complex (HDAC). CIR is also required for RBPSUH-mediated repression of transcription.
Synonyms CIR
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors
Protein Pathways Notch signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.