PARP2 Rabbit Polyclonal Antibody

CAT#: TA334261

Rabbit Polyclonal Anti-PARP2 Antibody

Product Images

Host: Rabbit; Target Name: PARP2; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: poly(ADP-ribose) polymerase 2
• Database Link:
  NP_001036083
  Entrez Gene 10038 Human
  UniProt ID Q9UGN5
• Background: PARP2 is involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.
• Synonyms: ADPRT2; ADPRTL2; ADPRTL3; ARTD2; pADPRT-2; PARP-2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair