PARP2 Rabbit Polyclonal Antibody

CAT#: TA334262

Rabbit Polyclonal Anti-PARP2 Antibody

Product Images

WB Suggested Anti-PARP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Raji cell lysatePARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

• 

  Sample Type. Rat thyrocytes-FRTL-5 Primary Antibody Dilution. 1:100 Secondary Antibody. Anti-rabbit-Texas Red Secondary Antibody Dilution. 1:100 Color/Signal Descriptions. Red: PARP2 Blue: DAPI Gene Name. PARP2Submitted by. Syed A Morshed, Mount Si

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: IF, WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: poly(ADP-ribose) polymerase 2
• Database Link:
  NP_005475
  Entrez Gene 290027 Rat
  UniProt ID Q9UGN5
• Background: PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.
• Synonyms: ADPRT2; ADPRTL2; ADPRTL3; ARTD2; pADPRT-2; PARP-2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Base excision repair