ATP7A Rabbit Polyclonal Antibody

CAT#: TA334273

Rabbit Polyclonal Anti-ATP7A Antibody

Product Images

Lanes: ; Lane 1: 40 ug mouse endothelial firboblast lysate; Lane 2: 40 ug human HUVEC lysate; Primary Antibody Dilution: ; 1:500; Secondary Antibody: ; Anti-rabbit HRP; Secondary Antibody Dilution: ; 1:2000; Gene Name: ; ATP7A; Submitted by: ; Anonymous;

• 

  WB Suggested Anti-ATP7A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysateATP7A is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP7A antibody: synthetic peptide directed towards the middle region of human ATP7A. Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 163 kDa
• Gene Name: ATPase copper transporting alpha
• Database Link:
  NP_000043
  Entrez Gene 11977 MouseEntrez Gene 538 Human
  UniProt ID Q04656
• Background: This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked distal spinal muscular atrophy, and occipital horn syndrome. Alternatively-spliced transcript variants have been observed. [provided by RefSeq, Aug 2013]
• Synonyms: DSMAX; MK; MNK; SMAX3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane