Asialoglycoprotein Receptor 1 (ASGR1) Rabbit Polyclonal Antibody

CAT#: TA334278

Rabbit Polyclonal Anti-ASGR1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "ASGR1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ASGR1 antibody is: synthetic peptide directed towards the middle region of Human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name asialoglycoprotein receptor 1
Background ASGR1 is a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Synonyms ASGPR; ASGPR1; CLEC4H1; HL-1
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Guinea pig: 92%; Mouse: 91%; Horse: 86%; Bovine: 85%; Yeast: 75%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.