Asialoglycoprotein Receptor 1 (ASGR1) Rabbit Polyclonal Antibody

CAT#: TA334279

Rabbit Polyclonal Anti-ASGR1 Antibody

Product Images

WB Suggested Antibody Titration: 0.2-1 ug/ml; Positive Control: Liver

• 

  Host: Rabbit; Target Name: ASGR1; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ASGR1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ASGR1; Sample Tissue: Human Fetal Kidney; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ASGR1; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ASGR1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: ASGR1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: ASGR1; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: ASGR1; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml; ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2

Show all 9 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASGR1 antibody: synthetic peptide directed towards the N terminal of human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: asialoglycoprotein receptor 1
• Database Link:
  NP_001662
  Entrez Gene 432 Human
  UniProt ID P07306
• Background: ASGR1 encodes for a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
• Synonyms: ASGPR; ASGPR1; CLEC4H1; HL-1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 92%; Guinea pig: 92%; Mouse: 91%; Horse: 86%; Bovine: 85%; Yeast: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane