Cholecystokinin (CCK) Rabbit Polyclonal Antibody

CAT#: TA334300

Rabbit Polyclonal Anti-CCK Antibody

Product Images

WB Suggested Anti-CCK Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK. Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: cholecystokinin
• Database Link:
  NP_000720
  Entrez Gene 885 Human
  UniProt ID P06307
• Background: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: MGC117187
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein