ARHGDIG Rabbit Polyclonal Antibody

CAT#: TA334303

Rabbit Polyclonal Anti-ARHGDIG Antibody

Product Images

WB Suggested Anti-ARHGDIG Antibody Titration: 0.2-1 ug/ml; Positive Control: Daudi cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARHGDIG antibody: synthetic peptide directed towards the N terminal of human ARHGDIG. Synthetic peptide located within the following region: DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: Rho GDP dissociation inhibitor gamma
• Database Link:
  NP_001167
  Entrez Gene 398 Human
  UniProt ID Q99819
• Background: ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.
• Synonyms: RHOGDI-3
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome