MRPL36 Rabbit Polyclonal Antibody

CAT#: TA334329

Rabbit Polyclonal Anti-MRPL36 Antibody

Product Images

Host: Rabbit; Target Name: MRPL36; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRPL36 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL36. Synthetic peptide located within the following region: PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: mitochondrial ribosomal protein L36
• Database Link:
  NP_115868
  Entrez Gene 64979 Human
  UniProt ID Q9P0J6
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p.
• Synonyms: BRIP1; L36mt; MRP-L36; PRPL36; RPMJ
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Zebrafish: 85%; Rat: 83%; Mouse: 83%; Dog: 82%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Yeast: 77%; Guinea pig: 75%