NAD Synthetase (NADSYN1) Rabbit Polyclonal Antibody
Other products for "NADSYN1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NADSYN1 antibody is: synthetic peptide directed towards the C-terminal region of Human NADSYN1. Synthetic peptide located within the following region: NQISYTPQDPRDLCGRILTTCYMASKNSSQETCTRARELAQQIGSHHISL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 78 kDa |
Gene Name | NAD synthetase 1 |
Database Link | |
Background | Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD). |
Synonyms | FLJ10631; FLJ36703; FLJ40627 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 85%; Pig: 85%; Rat: 85%; Guinea pig: 85% |
Reference Data | |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.