Pola2 Rabbit Polyclonal Antibody

CAT#: TA334350

Rabbit Polyclonal Anti-Pola2 Antibody

Product Images

Host: Rabbit; Target Name: Pola2; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pola2 antibody is: synthetic peptide directed towards the middle region of MOUSE Pola2. Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: polymerase (DNA directed), alpha 2
• Database Link:
  NP_001157529
  Entrez Gene 18969 Mouse
  UniProt ID P33611
• Background: The function of this protein remains unknown.
• Synonyms: FLJ21662; FLJ37250
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 86%