PTCD3 Rabbit Polyclonal Antibody

CAT#: TA334357

Rabbit Polyclonal Anti-PTCD3 Antibody

Product Images

Host: Rabbit; Target Name: PTCD3; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml; PTCD3 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTCD3 antibody is: synthetic peptide directed towards the C-terminal region of Human PTCD3. Synthetic peptide located within the following region: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: pentatricopeptide repeat domain 3
• Database Link:
  NP_060422
  Entrez Gene 55037 Human
  UniProt ID Q96EY7
• Background: Mitochondrial RNA-binding protein that has a role in mitochondrial translation.
• Synonyms: MRP-S39
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Mouse: 79%