GLO1 Rabbit Polyclonal Antibody

CAT#: TA334412

Rabbit Polyclonal Anti-GLO1 Antibody

Product Images

WB Suggested Anti-GLO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLO1 antibody: synthetic peptide directed towards the N terminal of human GLO1. Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: glyoxalase I
• Database Link:
  NP_006699
  Entrez Gene 2739 Human
  UniProt ID Q04760
• Background: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
• Synonyms: GLOD1; GLYI; HEL-S-74
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Yeast: 86%; Zebrafish: 86%

Reference Data

• Protein Pathways: Pyruvate metabolism