PHLDA1 Rabbit Polyclonal Antibody

CAT#: TA334415

Rabbit Polyclonal Anti-PHLDA1 Antibody

Product Images

WB Suggested Anti-PHLDA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHLDA1 antibody: synthetic peptide directed towards the middle region of human PHLDA1. Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: pleckstrin homology like domain family A member 1
• Database Link:
  NP_031376
  Entrez Gene 22822 Human
  UniProt ID Q8WV24
• Background: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
• Synonyms: DT1P1B11; PHRIP; TDAG51
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%