AKR7A3 Rabbit Polyclonal Antibody

CAT#: TA334423

Rabbit Polyclonal Anti-AKR7A3 Antibody

Product Images

WB Suggested Anti-AKR7A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKR7A3 antibody: synthetic peptide directed towards the middle region of human AKR7A3. Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)
• Database Link:
  NP_036199
  Entrez Gene 22977 Human
  UniProt ID O95154
• Background: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
• Synonyms: AFAR2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Bovine: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome